“First we eat, then we do everything else.” — M.F.K. Fisher
Recipe Breakfast American

Overnight Oats with Apple, Cardamom, and Toasted Pecans

Five minutes of work tonight buys you a breakfast tomorrow that tastes like you tried.

By Jon Ajinga · May 13, 2026

The case for overnight oats keeps making itself: five minutes of work tonight is a breakfast tomorrow that tastes like you tried. The texture is creamier than cooked oatmeal, the flavour mellows and deepens overnight, and you eat it cold straight from the jar with one hand while the other is doing something else.

Print recipe Cook mode
Total time 5 min
Prep 5 min
Cook 0 min
Cool 8 h
Makes 2 jars
Difficulty

Per serving

Calories 380
Fat 14g
Carbs 55g
Protein 11g
Breakfast American VegetarianGluten-free oatsbreakfastapplemake-aheadvegetariangluten-freemeal-prep

Instructions

  1. Toast the pecans first. Heat a dry skillet over medium and add the pecans. Shake the pan every 30 seconds. After about 4 minutes they'll smell warm and look slightly darker. Tip them onto a plate so they stop cooking. This step is optional. It is also non-negotiable.

  2. In a bowl or measuring cup, whisk the milk, yogurt (if using), maple syrup, vanilla, cardamom, and salt until the syrup dissolves.

  3. Divide the oats between the two jars. Pour the milk mixture over evenly. Stir each jar to ensure no dry pockets remain.

  4. Layer the diced apple on top of each jar. Don't stir it in — the apple stays brighter when it isn't sitting in the oat mixture overnight.

  5. Lid the jars and refrigerate for at least 6 hours and up to 3 days.

  6. In the morning, stir to incorporate the apple. Top with the toasted pecans and lemon zest, and a tiny pinch of cinnamon if you want it. Eat cold, or warm 90 seconds in the microwave with a splash of extra milk.

Cook's notes

Use rolled, never quick. Quick oats turn to paste overnight. Steel-cut don't hydrate fully without cooking.

The cardamom is the move. If you've never put cardamom in oats, this is your wake-up call. Use freshly ground if you have whole pods; the flavour is twice as bright.

Swap-friendly fruit. Pear, persimmon, or roasted plum all work in apple's place. In summer: peach + basil instead of apple + cardamom is a different recipe but follows the same template.

Source

A house staple, adapted endlessly from the Bob's Red Mill carton instructions until it bore no resemblance.


Comments Community guidelines